SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000127073 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000127073
Domain Number 1 Region: 25-105
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000133
Family YVTN repeat 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000127073   Gene: ENSMUSG00000024037   Transcript: ENSMUST00000170176
Sequence length 107
Comment pep:known chromosome:GRCm38:17:31494325:31512268:-1 gene:ENSMUSG00000024037 transcript:ENSMUST00000170176 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XAGGPMASSAGLALCAQTLVVRGGSRFLAFSTTGSDDDCVFTYDCSTAEKKATPEDKGED
GQPADTGSDSILASTFSKSGRYFALTDDSKRLILFRTKPWQCLSVRL
Download sequence
Identical sequences F6VLT8
ENSMUSP00000127073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]