SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000127375 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000127375
Domain Number 1 Region: 226-480
Classification Level Classification E-value
Superfamily Caspase-like 1.08e-87
Family Caspase catalytic domain 0.00000000496
Further Details:      
 
Domain Number 2 Region: 1-117
Classification Level Classification E-value
Superfamily DEATH domain 3.92e-32
Family DEATH effector domain, DED 0.0028
Further Details:      
 
Domain Number 3 Region: 98-179
Classification Level Classification E-value
Superfamily DEATH domain 7.3e-19
Family DEATH effector domain, DED 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000127375   Gene: ENSMUSG00000026029   Transcript: ENSMUST00000165549
Sequence length 480
Comment pep:known chromosome:GRCm38:1:58802502:58847008:1 gene:ENSMUSG00000026029 transcript:ENSMUST00000165549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFQSCLYAIAEELGSEDLAALKFLCLDYIPHKKQETIEDAQKLFLRLREKGMLEEGNLS
FLKELLFHISRWDLLVNFLDCNREEMVRELRDPDNAQISPYRVMLFKLSEEVSELELRSF
KFLLNNEIPKCKLEDDLSLLEIFVEMEKRTMLAENNLETLKSICDQVNKSLLGKIEDYER
SSTERRMSLEGREELPPSVLDEMSLKMAELCDSPREQDSESRTSDKVYQMKNKPRGYCLI
INNHDFSKAREDITQLRKMKDRKGTDCDKEALSKTFKELHFEIVSYDDCTANEIHEILEG
YQSADHKNKDCFICCILSHGDKGVVYGTDGKEASIYDLTSYFTGSKCPSLSGKPKIFFIQ
ACQGSNFQKGVPDEAGFEQQNHTLEVDSSSHKNYIPDEADFLLGMATVKNCVSYRDPVNG
TWYIQSLCQSLRERCPQGDDILSILTGVNYDVSNKDDRRNKGKQMPQPTFTLRKKLFFPP
Download sequence
Identical sequences O89110 Q3U607
10090.ENSMUSP00000027189 ENSMUSP00000027189 NP_001073595.1.92730 NP_033942.1.92730 ENSMUSP00000027189 ENSMUSP00000127375 ENSMUSP00000027189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]