SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000127568 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000127568
Domain Number 1 Region: 1-117
Classification Level Classification E-value
Superfamily Rhomboid-like 0.00000157
Family Rhomboid-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000127568   Gene: ENSMUSG00000018442   Transcript: ENSMUST00000171041
Sequence length 165
Comment pep:putative chromosome:GRCm38:11:71009933:71019841:-1 gene:ENSMUSG00000018442 transcript:ENSMUST00000171041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLVFLGQAFTIMLVYVWSR
RNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDIFPNQPG
GIRILKTPSILRTIFDTPDEDPNYNPLPEERPGGFAWGEGQRLGG
Download sequence
Identical sequences A0A1U8BUG3 Q3U957
NP_001278075.1.92730 NP_001278076.1.92730 XP_007624499.1.28591 XP_008766125.1.100692 XP_008773284.1.4139 XP_012967167.1.91757 XP_012967168.1.91757 XP_013202884.1.66349 XP_021068040.1.100879 XP_021068041.1.100879 ENSMUSP00000127568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]