SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000127885 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000127885
Domain Number 1 Region: 16-469
Classification Level Classification E-value
Superfamily SIS domain 2.67e-175
Family Phosphoglucose isomerase, PGI 0.0000000000000657
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000127885   Gene: ENSMUSG00000043192   Transcript: ENSMUST00000051687
Sequence length 471
Comment pep:known chromosome:GRCm38:8:5639584:5640996:1 gene:ENSMUSG00000043192 transcript:ENSMUST00000051687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRSPGTRSSRSCWSGTNLKLRELFEADPERFNNFSLNLNTNHGHILVDYSKNLVNKEVMQ
MLVELAKSRGVEAARDNMFSGSKINYTEDRAVLHVALRNRSNTPIKVVGKDVMPEVNRVL
DKMKSFCQTLTTQETITNAETAKEWFLEAAKDPSAVAKHFVALSTNTAKVKEFGIDPQNM
FEFWDWVGGRYSLWSATGPSIALHVGFDHFEQLLSGAHWMDQHFLKTPLEKNAPVLLALL
GIWYINCYGCETHALLPYDQYMYRFAAYFQQGDMESNGKYITKSGARVDHQTGPIVWGEP
GTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMMGKLPE
EARKELQAAGKSPEDLEKLLPHKVFEGNRPTNSIVFTKLTPFILGALIAMYEHKIFVQGI
MWDINSFDQWGVELGKQLAKKIEPELEGSSAVTSHDSSTNGLISFIKQQWD
Download sequence
Identical sequences ENSMUSP00000127885 ENSMUSP00000127885 ENSMUSP00000127885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]