SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000128947 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000128947
Domain Number 1 Region: 1-427
Classification Level Classification E-value
Superfamily Ras GEF 6.02e-108
Family Ras GEF 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000128947   Gene: ENSMUSG00000029333   Transcript: ENSMUST00000166484
Sequence length 431
Comment pep:novel chromosome:GRCm38:5:99218774:99243240:-1 gene:ENSMUSG00000029333 transcript:ENSMUST00000166484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQTPPFSAMFDSSGYNRNLYQSAEDSCGGLYYHDNNLLSGSLEALIQHLVPNVDYYPDN
QMRKIAPKILQLLTEWTETFPYDFRDERMMRNLKDLAHRMASGEETYRKNVQQMMQCLIR
KLAALSQYEEVLAKLSSTATDRLTVLKTKPQSIQRDIMTVCSDPYTLAQQLTHIELERLN
YIGPEEFVQAFVQKDPLDNDKSCYSERKKTRNLEAYVEWFNRLSYLVATEICMPVKKKHR
ARMIEYFIDVARECFNIGNFNSLMAIISGMNMSPVSRLKKTWAKVKTAKFDILEHQMDPS
SNFYNYRTALRGAAQRSLTAHSSREKIVIPFFSLLIKDIYFLNEGCVNRLPNGHVNFEKF
WELAKQVSEFMTWKQVECPFERDRKVLQYLLSVPVFSEDALYLASYESEGPENNIEKDRW
KSLRSSLLGRV
Download sequence
Identical sequences E9Q813
XP_021066083.1.100879 ENSMUSP00000128947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]