SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129481 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129481
Domain Number 1 Region: 19-330
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.53e-112
Family Protein prenyltransferases 0.0000000000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129481   Gene: ENSMUSG00000038975   Transcript: ENSMUST00000167111
Sequence length 339
Comment pep:known chromosome:GRCm38:3:153907289:153912203:-1 gene:ENSMUSG00000038975 transcript:ENSMUST00000167111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLLFSWKGTQQKDVTIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGVYW
GLTVMDLMGQLHRMNREEILVFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSVH
VINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVL
SCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGR
PEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTL
FGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Download sequence
Identical sequences P53612
NP_035361.2.92730 ENSMUSP00000129481 10090.ENSMUSP00000087396 ENSMUSP00000129481 ENSMUSP00000087396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]