SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129652 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129652
Domain Number 1 Region: 1-468
Classification Level Classification E-value
Superfamily Ras GEF 6.67e-121
Family Ras GEF 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129652   Gene: ENSMUSG00000029333   Transcript: ENSMUST00000168092
Sequence length 472
Comment pep:known chromosome:GRCm38:5:99217426:99252927:-1 gene:ENSMUSG00000029333 transcript:ENSMUST00000168092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQTPPFSAMFDSSGYNRNLYQSAEDSCGGLYYHDNNLLSGSLEALIQHLVPNVDYYPDR
TYIFTFLLSSRLFMHPYELMAKVCHLCVEHQRLSEGDGDKNQMRKIAPKILQLLTEWTET
FPYDFRDERMMRNLKDLAHRMASGEETYRKNVQQMMQCLIRKLAALSQYEEVLAKLSSTA
TDRLTVLKTKPQSIQRDIMTVCSDPYTLAQQLTHIELERLNYIGPEEFVQAFVQKDPLDN
DKSCYSERKKTRNLEAYVEWFNRLSYLVATEICMPVKKKHRARMIEYFIDVARECFNIGN
FNSLMAIISGMNMSPVSRLKKTWAKVKTAKFDILEHQMDPSSNFYNYRTALRGAAQRSLT
AHSSREKIVIPFFSLLIKDIYFLNEGCVNRLPNGHVNFEKFWELAKQVSEFMTWKQVECP
FERDRKVLQYLLSVPVFSEDALYLASYESEGPENNIEKDRWKSLRSSLLGRV
Download sequence
Identical sequences ENSMUSP00000129652 NP_851835.1.92730 XP_021066082.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]