SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000130269 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000130269
Domain Number 1 Region: 225-523
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.16e-84
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000249
Further Details:      
 
Domain Number 2 Region: 525-631
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 9.51e-24
Family Anticodon-binding domain of Class II aaRS 0.0013
Further Details:      
 
Domain Number 3 Region: 133-221
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.79e-19
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0034
Further Details:      
 
Domain Number 4 Region: 66-127
Classification Level Classification E-value
Superfamily TGS-like 0.000000000000589
Family TGS domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000130269   Gene: ENSMUSG00000028107   Transcript: ENSMUST00000163530
Sequence length 642
Comment pep:known chromosome:GRCm38:3:95739976:95754977:-1 gene:ENSMUSG00000028107 transcript:ENSMUST00000163530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLCLRWRRLGFPLPEFRRCELHTVREASAPTPPHWLAERFGLFEELWTAHVKKLASMTQ
KKARAIKISLPEGQKVDAVAWNTTPYQLAHQISVTLADTAVAAEVNGELYDLDRPLETDC
HLRFLTFDSPEGKADNHFKLHLIEEKVTGPTATVYGCGMSVDLCRGPHLRHTGQIGALKL
LTNSSALWRSLGAPETLQRVSGISFPKVELLRNWEARREAAELRDHRRIGKEQELFFFHE
LSPGSCFFLPRGTRVYNALVAFIRAEYARRGFSEVKTPTLFSTKLWEQSGHWEHYRADMF
SLKPPGTDGVDNSQSGHPARCPKDTLALKPMNCPAHCLMFAHRPRSWRELPVRLADFGAL
HRAEASGSLGGLTRLWRFQQDDAHIFCAPHQLEAEIQGCLDFLRCVYSVLGFSFHLALST
RPPGFLGEPRLWDQAEQVLQQALEKFGEPWDLNPGDGAFYGPKIDVHLHDALGRPHQCGT
IQLDFQLPLRFDLQYKGPAGTPECPVLIHRAVLGSVERLLGVLAESCGGKWPLWLSPLQV
VVIPVRTEQEEYARQVQQCLQAAGLVSDLDADSGLTLSRRVRRAQLAHYNFQFVVGQREQ
SQRTVNVRTRDNRQLGERDLAESVQRLLELQNARVPNAEEVF
Download sequence
Identical sequences E9Q7H6
ENSMUSP00000130269 NP_001157090.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]