SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000130382 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000130382
Domain Number 1 Region: 70-258
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-35
Family YWTD domain 0.000000808
Further Details:      
 
Domain Number 2 Region: 25-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family EGF-type module 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000130382
Domain Number - Region: 1-24
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0157
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000130382   Gene: ENSMUSG00000024924   Transcript: ENSMUST00000165761
Sequence length 258
Comment pep:novel chromosome:GRCm38:19:27238774:27243828:1 gene:ENSMUSG00000024924 transcript:ENSMUST00000165761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDMSKVCDQEQDCRDWSDEPLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFELIDR
KTCGGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQKAI
FSASIDDKVGRHFKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGAKRKFLFNS
DLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTEDIQWPNGITLDLVKSR
LYWLDSKLHMLSSVDLNG
Download sequence
Identical sequences F6RKS4
ENSMUSP00000130382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]