SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000130996 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000130996
Domain Number 1 Region: 34-127
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000136
Family Fibronectin type III 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000130996   Gene: ENSMUSG00000071984   Transcript: ENSMUST00000167580
Sequence length 150
Comment pep:known chromosome:GRCm38:17:7782444:7827302:-1 gene:ENSMUSG00000071984 transcript:ENSMUST00000167580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEARASPRLLLRAALLLLAALLPVATSAGPPEKEVPNKPLRMRVRASDDRLSVAWKAP
RLSGAKSPRRSRGFLLGYGESGRKMNYVPLTRDERSHEIKKLASESVYVVSLQSTNSQGQ
SQPVYRAALTKRKHAEEDELDVPEDISVRV
Download sequence
Identical sequences E9Q8V0
ENSMUSP00000130996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]