SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131255 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000131255
Domain Number - Region: 2-50
Classification Level Classification E-value
Superfamily SIS domain 0.02
Family mono-SIS domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131255   Gene: ENSMUSG00000025404   Transcript: ENSMUST00000171434
Sequence length 62
Comment pep:known chromosome:GRCm38:10:127420338:127452014:1 gene:ENSMUSG00000025404 transcript:ENSMUST00000171434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNSNTTQETLEIMKESEKKLVEESVNKNKFISKTPSKEDVEKEGEENGLRQETQRRTSS
HG
Download sequence
Identical sequences E9PZ57
ENSMUSP00000131255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]