SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131316 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131316
Domain Number 1 Region: 3902-4095
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.29e-40
Family Laminin G-like module 0.0008
Further Details:      
 
Domain Number 2 Region: 4156-4355
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.05e-37
Family Laminin G-like module 0.00066
Further Details:      
 
Domain Number 3 Region: 1641-1657,3661-3838
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.29e-34
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 405-490
Classification Level Classification E-value
Superfamily Immunoglobulin 2.82e-21
Family I set domains 0.0083
Further Details:      
 
Domain Number 5 Region: 3207-3301
Classification Level Classification E-value
Superfamily Immunoglobulin 3.89e-21
Family I set domains 0.0082
Further Details:      
 
Domain Number 6 Region: 3569-3656
Classification Level Classification E-value
Superfamily Immunoglobulin 5.89e-19
Family I set domains 0.02
Further Details:      
 
Domain Number 7 Region: 1954-2043
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 8 Region: 3105-3198
Classification Level Classification E-value
Superfamily Immunoglobulin 2.12e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 9 Region: 3474-3572
Classification Level Classification E-value
Superfamily Immunoglobulin 2.34e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 10 Region: 2627-2714
Classification Level Classification E-value
Superfamily Immunoglobulin 3.12e-17
Family I set domains 0.021
Further Details:      
 
Domain Number 11 Region: 1678-1770
Classification Level Classification E-value
Superfamily Immunoglobulin 3.98e-17
Family I set domains 0.022
Further Details:      
 
Domain Number 12 Region: 3291-3379
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-16
Family I set domains 0.013
Further Details:      
 
Domain Number 13 Region: 3019-3114
Classification Level Classification E-value
Superfamily Immunoglobulin 1.36e-16
Family I set domains 0.034
Further Details:      
 
Domain Number 14 Region: 1771-1858
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-16
Family I set domains 0.0000226
Further Details:      
 
Domain Number 15 Region: 2435-2524
Classification Level Classification E-value
Superfamily Immunoglobulin 6.08e-16
Family V set domains (antibody variable domain-like) 0.081
Further Details:      
 
Domain Number 16 Region: 2824-2909
Classification Level Classification E-value
Superfamily Immunoglobulin 6.57e-16
Family I set domains 0.038
Further Details:      
 
Domain Number 17 Region: 2535-2618
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000107
Family I set domains 0.045
Further Details:      
 
Domain Number 18 Region: 2053-2139
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000036
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 
Domain Number 19 Region: 2724-2809
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000167
Family I set domains 0.057
Further Details:      
 
Domain Number 20 Region: 2244-2325
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000308
Family I set domains 0.046
Further Details:      
 
Domain Number 21 Region: 1864-1951
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000413
Family I set domains 0.025
Further Details:      
 
Domain Number 22 Region: 3396-3487
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000437
Family I set domains 0.014
Further Details:      
 
Domain Number 23 Region: 2343-2436
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000114
Family V set domains (antibody variable domain-like) 0.056
Further Details:      
 
Domain Number 24 Region: 2921-3006
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000154
Family I set domains 0.084
Further Details:      
 
Domain Number 25 Region: 2150-2238
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000166
Family I set domains 0.049
Further Details:      
 
Domain Number 26 Region: 764-816
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000165
Family Laminin-type module 0.0047
Further Details:      
 
Domain Number 27 Region: 1563-1615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000502
Family Laminin-type module 0.0066
Further Details:      
 
Domain Number 28 Region: 367-411
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 29 Region: 324-361
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000117
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 30 Region: 283-319
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000123
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 31 Region: 1159-1211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000156
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 32 Region: 824-871
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 33 Region: 3834-3875
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000318
Family EGF-type module 0.012
Further Details:      
 
Domain Number 34 Region: 194-234
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000537
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 35 Region: 4098-4141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000873
Family EGF-type module 0.01
Further Details:      
 
Domain Number 36 Region: 1622-1670
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000159
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 37 Region: 1219-1263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000279
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000131316
Domain Number - Region: 1275-1322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00022
Family Laminin-type module 0.006
Further Details:      
 
Domain Number - Region: 887-926
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0014
Family Laminin-type module 0.028
Further Details:      
 
Domain Number - Region: 1119-1161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00142
Family Laminin-type module 0.078
Further Details:      
 
Domain Number - Region: 1528-1565
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00565
Family Integrin beta EGF-like domains 0.089
Further Details:      
 
Domain Number - Region: 724-766
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0137
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131316   Gene: ENSMUSG00000028763   Transcript: ENSMUST00000171332
Sequence length 4383
Comment pep:known chromosome:GRCm38:4:137468803:137570629:1 gene:ENSMUSG00000028763 transcript:ENSMUST00000171332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQRAVGSLLLGLLLHARLLAVTHGLRAYDGLSLPEDTETVTASRYGWTYSYLSDDEDLL
ADDASGDGLGSGDVGSGDFQMVYFRALVNFTRSIEYSPQLEDASAKEFREVSEAVVEKLE
PEYRKIPGDQIVSVVFIKELDGWVFVELDVGSEGNADGSQIQEVLHTVVSSGSIGPYVTS
PWGFKFRRLGTVPQFPRVCTETEFACHSYNECVALEYRCDRRPDCRDMSDELNCEEPVPE
LSSSTPAVGKVSPLPLWPEAATTPPPPVTHGPQFLLPSVPGPSACGPQEASCHSGHCIPR
DYLCDGQEDCRDGSDELGCASPPPCEPNEFACENGHCALKLWRCDGDFDCEDRTDEANCS
VKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQSIQASR
GQTVTFTCVATGVPTPIINWRLNWGHIPAHPRVTMTSEGGRGTLIIRDVKEADQGAYTCE
AMNSRGMVFGIPDGVLELVPQRGPCPDGHFYLEDSASCLPCFCFGVTNVCQSSLRFRDQI
RLSFDQPNDFKGVNVTMPSQPGVPPLSSTQLQIDPALQEFQLVDLSRRFLVHDAFWALPK
QFLGNKVDSYGGFLRYKVRYELARGMLEPVQKPDVILVGAGYRLHSRGHTPTHPGTLNQR
QVQLSEEHWVHESGRPVQRAEMLQALASLEAVLLQTVYNTKMASVGLSDIVMDTTVTHTT
IHGRAHSVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGHC
LNCQHNTEGPQCDKCKPGFFGDATKATATACRPCPCPYIDASRRFSDTCFLDTDGQATCD
ACAPGYTGRRCESCAPGYEGNPIQPGGKCRPTTQEIVRCDERGSLGTSGETCRCKNNVVG
RLCNECSDGSFHLSKQNPDGCLKCFCMGVSRQCSSSSWSRAQVLGASEQPSQFSLSNAAG
THTTSEGVSSPAPGELSFSSFHNLLSEPYFWSLPASFRGDKVTSYGGELRFTVTQRPRPS
SAPLHRQPLVVLQGNNIVLEHHASRDPSPGQPSNFIVPFQEQAWQRPDGQPATREHLLMA
LAGIDALLIQASYTQQPAESRVSGISMDVAVPENTGQDSAREVEQCTCPPGYRGPSCQDC
DTGYTRVPSGLYLGTCERCNCHGHSETCEPETGACQSCQHHTEGASCEQCQPGYYGDAQR
GTPQDCQPCPCYGAPAAGQAAHTCFLDTDGHPTCDSCSPGHSGRHCERCAPGYYGNPSQG
QPCHRDGQVPEVLGCGCDPHGSISSQCDAAGQCQCKAQVEGRTCSHCRPHHFHLSASNPE
GCLPCFCMGVTQQCASSSYSRQLISTHFAPGDFQGFALVNPQRNSQLTGGFTVEPVHDGA
RLSFSNFAHLGQESFYWQLPEIYQGDKVAAYGGKLRYTLSYTAGPQGSPLLDPDIQITGN
NIMLVASQPALQGPERRSYEIIFREEFWRRPDGQPATREHLLMALADLDELLVRATFSSV
PRAASISAVSLEVAQPGPSSGPRALEVEECRCPPGYVGLSCQDCAPGYTRTGSGLYLGQC
ELCECNGHSDLCHPETGACSRCQHNTAGEFCELCATGYYGDATAGTPEDCQPCACPLTNP
ENMFSRTCESLGAGGYRCTACEPGYTGQYCEQCAPGYEGDPNVQGGRCQPLTKESLEVQI
HPSRSVVPQGGPHSLRCQVSGSPPHYFYWSREDGRPLPSSAQQRHQGSELHFPSVQPSDA
GVYICTCRNLIHTSNSRAELLVAEAPSKPITVTVEEQRSQSVRPGADVTFICTAKSKSPA
YTLVWTRLHNGKLPSRAMDFNGILTIRNVQPSDAGTYVCTGSNMFAMDQGTATLHVQVSG
TSTAPVASIHPPQLTVQPGQQAEFRCSATGNPTPMLEWIGGPSGQLPAKAQIHNGILRLP
AIEPSDQGQYLCRALSSAGQHVARAMLQVHGGSGPRVQVSPERTQVHEGRTVRLYCRAAG
VPSASITWRKEGGSLPPQARSENTDIPTLLIPAITAADAGFYLCVATSPTGTAQARIQVV
VLSASGANSVPVRIESSSPSVTEGQTLDLNCAVMGLTYTQVTWYKRGGSLPPHAQVHGSR
LRLPQVSPADSGDYVCRVESDVGPKEASIVVSVLHSPHSGPSYTPATSITPPIRIESSSS
HVAEGQTLDLNCVVPGQAQVTWRKRGGSLPARHQTHGSLLRLHQVSPADSGEYVCHVVLG
SEHTETSVLVTIEPAESIPAPGPAPPVRIEASSSTVTEGHMLDLNCVVAGQAHAQVTWYK
RGGSLPARHQVRGSRLYILQASPADAGEYVCRAGNGQEATITVTVTRNHGANLAYPPGST
SPIRIESSSSHVAEGQTLDLNCVVQGQAHAQVTWHKRGGSLPARHQTHGSLLRLHQVSPV
DSGEYVCRVEGGAVPLESSVLVTIEPAGTAPGVIPPVRIESSSSHVSEGQSLDLNCLVSG
QTHPQISWHKRGGSLPARHQVHGSRLRLLQVTPTDSGEYVCRVVSGSGTQEASILVTIQQ
TLSPSHSQSVVHPVRIESSSPSLANGHTLDLNCLVASLTPHTITWYKRGGSLPSRHQIVG
SRLRIPQVTPADSGEYVCHVSNGAGSQETSLIVTIESRGPSHVPSVSPPMRIETSSPTVT
EGQTLDLNCVVVGRPQATITWYKRGGSLPFRHQAHGSRLRLHHMSVADSGEYVCRANNNI
DAQETSIMISVSPSTNSPPAPASPAPIRIESSSSRVAEGQTLDLNCVVPGHAHAQVTWHK
RGGSLPTHHQTHGSRLRLYQVSSADSGEYVCSVLSSSGPLEASVLVSITPAAANVHIPGE
VPFPPIRIETSSSRVAEGQTLDLSCVVPGQAHAQVTWHKRGGSLPAGHQVHGHMLRLNRV
SPADSGEYSCQVTGSSGTLEASVLVTIEASEPSPIPAPGLAQPVYIESSSSHLTEGQTVD
LKCVVPGQAHAQVTWHKRGSSLPARHQTHGSLLRLYQLSPADSGEYVCQVAGSSHPEHEA
SFKLTVPSSQNSSFRLRSPVISIEPPSSTVQQGQDASFKCLIHEGATPIKVEWKIRDQEL
EDNVHISPNGSIITIVGTRPSNHGAYRCVASNVYGMAQSVVNLSVHGPPTVSVLPEGPVH
VKMGKDITLECISSGEPRSSPRWTRLGIPVKLEPRMFGLMNSHAMLKIASVKPSDAGTYV
CQAQNALGTAQKQVELIVDTGTVAPGAPQVQVEESELTLEAGHTATLHCSATGNPPPTIH
WSKLRAPLPWQHRIEGNTLVIPRVAQQDSGQYICNATNSAGHTEATVVLHVESPPYATII
PEHTSAQPGNLVQLQCLAHGTPPLTYQWSLVGGVLPEKAVARNQVLRLEPTVPEDSGRYR
CQVSNRVGSAEAFAQVLVQGSSSNLPDTSIPGGSTPTVQVTPQLETRNIGASVEFHCAVP
NERGTHLRWLKEGGQLPPGHSVQDGVLRIQNLDQSCQGTYVCQAHGPWGQAQATAQLIVQ
ALPSVLINVRTSVHSVVVGHSVEFECLALGDPKPQVTWSKVGGHLRPGIVQSGSIIRIAH
VELADAGQYRCAATNAAGTTQSHVLLLVQALPQISTPPEIRVPAGSAAVFPCMASGYPTP
AITWSKVDGDLPPDSRLENNMLMLPSVRPEDAGTYVCTATNRQGKVKAFAYLQVPERVIP
YFTQTPYSFLPLPTIKDAYRKFEIKITFRPDSADGMLLYNGQKRSPTNLANRQPDFISFG
LVGGRPEFRFDAGSGMATIRHPTPLALGQFHTVTLLRSLTQGSLIVGNLAPVNGTSQGKF
QGLDLNEELYLGGYPDYGAIPKAGLSSGFVGCVRELRIQGEEVVFHDVNLTTHGISHCPT
CQDRPCQNGGQCQDSESSSYTCVCPAGFTGSRCEHSQALHCHPEACGPDATCVNRPDGRG
YTCRCHLGRSGVRCEEGVTVTTPSMSGAGSYLALPALTNMHHELRLDVEFKPLEPNGILL
FSGGKSGPVEDFVSLAMVGGHLEFRYELGSGLAVLRSHEPLTLGRWHRVSAERLNKDGSL
RVDGGRPVLRSSPGKSQGLNLHTLLYLGGVEPSVQLSPATNMSAHFHGCVGEVSVNGKRL
DLTYSFLGSQGVGQCYDSSPCERQPCQNGATCMPAGEYEFQCLCQDGFKGDLCEHEENPC
QLHEPCLNGGTCRGARCLCLPGFSGPRCQQGAGYGVVESDWHPEGSGGNDAPGQYGAYFY
DNGFLGLPGNSFSRSLPEVPETIEFEVRTSTADGLLLWQGVVREASRSKDFISLGLQDGH
LVFSYQLGSGEARLVSEDPINDGEWHRITALREGQRGSIQVDGEDLVTGRSPGPNVAVNT
KDIIYIGGAPDVATLTRGKFSSGITGCIKNLVLHTARPGAPPPQPLDLQHRAQAGANTRP
CPS
Download sequence
Identical sequences E9PZ16
ENSMUSP00000131316 NP_032331.2.92730 ENSMUSP00000131316 ENSMUSP00000131316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]