SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131830 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131830
Domain Number 1 Region: 416-561
Classification Level Classification E-value
Superfamily CBS-domain pair 0.000000000000024
Family CBS-domain pair 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000131830
Domain Number - Region: 652-708
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00106
Family cAMP-binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131830   Gene: ENSMUSG00000025189   Transcript: ENSMUST00000165311
Sequence length 951
Comment pep:known chromosome:GRCm38:19:43440436:43497212:1 gene:ENSMUSG00000025189 transcript:ENSMUST00000165311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAAAAALGVRLRDCCSRGAVLLLFFSLSPRPPAAAAWLLGLRPEDTAGGRVSLEGG
TLRAAEGTSFLLRVYFQPGPPVPAAPVPAPSLAPGENGTGDWAPRLVFIEEPPGAGGAAP
SAVPTRPPGPQRCREQSDWASDVEVLGPLRPGGVAGSALVQVRVRELRKGEAERGGAGGG
GKLFSLCAWDGRAWHHHGAAGGFLLRVRPRLYGPGGDLLPPAWLRALGALLLLALSALFS
GLRLSLLSLDPVELRVLRNSGSAAEQEQARRVQAVRGRGTHLLCTLLLGQAGANAALAGW
LYASLPPGVGDPGEDSGEAGVHFPWLPALVCTGAVFLGAEICPYSVCSRHGLAIASHSVC
LTRLLMAAAFPVCYPLGRLLDWALRQEISTFYTREKLLETLRAADPYSDLVKEELNIIQG
ALELRTKVVEEVLTPLGDCFMLRSDAVLDFATVSEILRSGYTRIPVYEGDQRHNIVDILF
VKDLAFVDPDDCTPLLTVTRFYNRPLHCVFNDTRLDTVLEEFKKGKSHLAIVQRVNNEGE
GDPFYEVMGIVTLEDIIEEIIKSEILDETDLYTDNRKKQRVPHRERRRHDFSLFKLSDSE
IRVKISPQLLLATHRFMATEVEPFKSLYLSEKILLRLLKHPNVIQELKFDERNKKAPEHY
LYQRNRPVDYFVLLLQGKVEVEVGKEGLRFENGAFTYYGVPAIMTSACSDNDVRKVGSLA
GSSVFLNRSPSRCSGLNRSESPNRERSDFGGSNTQLYSSSNNLYTPDYSVHILSDVQFVK
ITRQQYQNALTACHMDSSPQSPDMEAFTDGDSTKAPTTRGTPQTPKDDPVLTLLSNRTSL
PCSRSDGLRSPGEVVYLRMEEMAFPQEEMPNFEEHRSQQVSLSPVAVPTTAASDPECCNI
HLDPEASPCSSDSEENMGKKLLRTLSGRKRKKSADGERASEENSNLTPLIT
Download sequence
Identical sequences Q0GA42
ENSMUSP00000131830 ENSMUSP00000131830 ENSMUSP00000131830 NP_113573.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]