SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131833 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131833
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily POZ domain 4.32e-19
Family BTB/POZ domain 0.00012
Further Details:      
 
Domain Number 2 Region: 55-96
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 5.1e-17
Family Skp1 dimerisation domain-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131833   Gene: ENSMUSG00000036309   Transcript: ENSMUST00000166537
Sequence length 96
Comment pep:novel chromosome:GRCm38:11:52232037:52245097:1 gene:ENSMUSG00000036309 transcript:ENSMUST00000166537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKAAN
YLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKND
Download sequence
Identical sequences E9PUV4
ENSMUSP00000131833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]