SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132244 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132244
Domain Number 1 Region: 49-485
Classification Level Classification E-value
Superfamily Ras GEF 4.05e-104
Family Ras GEF 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132244   Gene: ENSMUSG00000030134   Transcript: ENSMUST00000164960
Sequence length 489
Comment pep:known chromosome:GRCm38:6:118066385:118091546:1 gene:ENSMUSG00000030134 transcript:ENSMUST00000164960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLEPQEAMPQTSVVFSSILGPNCNRQVQPGMGERGGGASSGSKDLIFQDGRLTSGSLEA
LMEHLVPTVDYYPDRTYIFTFLLSSRVFMPPHDLLARVGQICLEQRQQLEAGPEKAKLKS
FSTKIVQLLKEWTEAFPYDFQDEKVMAELKAIAHRVTQCDEENGTVKKAIAQMIQSLLLS
LAARSQLQELREKLRSPVVDKGPVLKAKPPAAQKDILGVCSDPLVLAQQLTHIELERVNS
IRPEDLMQIISHMDSLDNHRCRGDMTKTFSLEAYDNWFNCLSMLVATEVCRVVKKKHRTR
MLEFFIDVARECFNIGNFNSMMAIISGMNLSPVARLKKTWSKVKTAKFDVLEHHMDPSSN
FCNYRTALQGATQRSQTANSSREKIVIPVFNLFVKDIYFLHKIHTNHLPNGHINFKKFWE
ISRQIHEFMTWTQVECPFEKDKKIQSYVLTAPIYSEEALFIASFESEGPENHMEKDSWKA
LRTTLLNRA
Download sequence
Identical sequences A0A0N4SVF2
NP_081802.1.92730 ENSMUSP00000132244 ENSMUSP00000132244 ENSMUSP00000132244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]