SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132533 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132533
Domain Number 1 Region: 21-255
Classification Level Classification E-value
Superfamily Ras GEF 3.53e-76
Family Ras GEF 0.0000631
Further Details:      
 
Domain Number 2 Region: 430-548
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000213
Family Pleckstrin-homology domain (PH domain) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132533   Gene: ENSMUSG00000026594   Transcript: ENSMUST00000172057
Sequence length 555
Comment pep:known chromosome:GRCm38:1:156804166:156939602:-1 gene:ENSMUSG00000026594 transcript:ENSMUST00000172057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLMNGQASSVTIAATVSEGQITLMDVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTR
RFNHVSFWVVREILHAQTLKIRAEVLSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRL
TKTWALLSRKDKTTFEKLEYVMSKEDNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSA
YPSTGSILENEQRSNLMNNILRIISDLQQSCEYDIPILPHVQKYLNSVQYIEELQKFVED
DNYKLSLKIEPGASTPRSAASREDLAGPDIGASPQGGRKSSAAAAAAAAAEGALLPQTPP
SPRNLIPHGHRKCHSLGYNFIHKMNTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQAES
STLSSGISIGSSDGSELSEETSWPAFERNRLYHSLGPVTRVPRNGYRSHTKASSSAESED
LAVHLYPGAVTIQGVLRRKTLLKEGKKPTVASWTKYWAALCGTQLFYYAAKSLKATERKH
FKSTSNKNVSVVGWMVMMADDPEHPDLFLLTDSEKGNSYKFQAGSRMNAMLWFKHLSAAC
QSNKQQVPTNLMTFE
Download sequence
Identical sequences ENSMUSP00000132533 NP_001153440.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]