SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132814 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132814
Domain Number 1 Region: 12-194
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.25e-42
Family Eukaryotic proteases 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132814   Gene: ENSMUSG00000052099   Transcript: ENSMUST00000165710
Sequence length 240
Comment pep:novel chromosome:GRCm38:14:64093696:64097666:1 gene:ENSMUSG00000052099 transcript:ENSMUST00000165710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSHGKLELVAVNVTVVMGIKTFSDTNLERKQVQKIIAHRDYKPPDLDSDLCLLLLATP
IQFNKDKMPICLPQRENSWDRCWMSEWAYTHGHGSAKGSNMHLKKLRVVQISWRTCAKRV
TQLSRNMLCAWKEVGTNGKCQGDSGAPMVCANWETRRLFQVGVFSWGITSGSRGRPGIFV
SVAQFIPWILEETQREGRALALSKASKSLLAGSPRYHPILLSMGSQILLAAIFSDDKSNC
Download sequence
Identical sequences E9PXD1
ENSMUSP00000132814 ENSMUSP00000132814 NP_001180560.1.92730 XP_006518375.1.92730 XP_017171228.1.92730 ENSMUSP00000132814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]