SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133077 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133077
Domain Number 1 Region: 70-153
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.28e-27
Family Nuclear receptor 0.00014
Further Details:      
 
Domain Number 2 Region: 175-250
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.000000000000606
Family Nuclear receptor ligand-binding domain 0.00000908
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133077   Gene: ENSMUSG00000002250   Transcript: ENSMUST00000169040
Sequence length 252
Comment pep:known chromosome:GRCm38:17:28272193:28298716:1 gene:ENSMUSG00000002250 transcript:ENSMUST00000169040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPQEETPEAREEEKEEVAMGDGAPELNGGPEHTLPSSSCADLSQNSSPSSLLDQLQMG
CDGASGGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCDRICKIQKKN
RNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKH
IYNAYLKNFNMTKKKARSILTGKSSHNAPFVIHDIETLWQAEKGLVWKQLVNGLPPYNEI
SVHVFYRCQSTT
Download sequence
Identical sequences E9PV57
ENSMUSP00000133077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]