SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133374 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133374
Domain Number 1 Region: 46-189
Classification Level Classification E-value
Superfamily Cupredoxins 1.02e-50
Family Multidomain cupredoxins 0.000000232
Further Details:      
 
Domain Number 2 Region: 2-38
Classification Level Classification E-value
Superfamily Cupredoxins 0.0000000000552
Family Multidomain cupredoxins 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133374   Gene: ENSMUSG00000003617   Transcript: ENSMUST00000172860
Sequence length 197
Comment pep:putative chromosome:GRCm38:3:19985612:19992582:1 gene:ENSMUSG00000003617 transcript:ENSMUST00000172860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEDSACIPWAYYSTVDRVKDLYSGLIGPLIVCRKSYVKVFSPKKKMEFFLLFLVFDENES
WYLDDNIKTYSEHPEKVNKDNEEFLESNKMHAINGKMFGNLQGLTMHVKDEVNWYVMGMG
NEIDLHTVHFHGHSFQYKHRGVYSSDVFDLFPGTYQTLEMFPQTPGTWLLHCHVTDHVHA
GMATTYTVLPVEQGKSR
Download sequence
Identical sequences G3UWP5
ENSMUSP00000133374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]