SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133584 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133584
Domain Number 1 Region: 78-130
Classification Level Classification E-value
Superfamily Ribosomal protein S18 0.00000000000942
Family Ribosomal protein S18 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133584   Gene: ENSMUSG00000024436   Transcript: ENSMUST00000174807
Sequence length 188
Comment pep:putative chromosome:GRCm38:17:35910386:35916330:-1 gene:ENSMUSG00000024436 transcript:ENSMUST00000174807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVPTLLRSSYVAQVPLQTLCTRGPPEEDAPSSLPVSPYESEPWKYLDSEEYHNRYGSRPV
WADYRRNHKGGVPPQRTRKTCIRNNKVAGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGI
IFHAPYTGEPWYPWYSWQQPPERELSRLRRLYQGNLLEESGPPPESMPEMPTTPPAESSI
EQPGSQSA
Download sequence
Identical sequences G3UX79
ENSMUSP00000133584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]