SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133661 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133661
Domain Number 1 Region: 132-408
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.13e-77
Family Nuclear receptor ligand-binding domain 0.0000000018
Further Details:      
 
Domain Number 2 Region: 80-159
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.03e-30
Family Nuclear receptor 0.0000142
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000133661
Domain Number - Region: 53-93
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 0.00942
Family Hydrophobin II, HfbII 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133661   Gene: ENSMUSG00000039656   Transcript: ENSMUST00000173354
Sequence length 414
Comment pep:known chromosome:GRCm38:17:34032375:34037815:1 gene:ENSMUSG00000039656 transcript:ENSMUST00000173354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPV
LGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRD
NKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGDGAGGAPEEMPVDR
ILEAELAVEQKSDQGVEGPGATGGGGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSL
PLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRSLSR
VLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPGEVEILREKVYASLETYCKQKY
PEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
Download sequence
Identical sequences Q8VCR0
ENSMUSP00000133661 NP_001192144.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]