SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133676 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133676
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily Cupredoxins 1.22e-34
Family Multidomain cupredoxins 0.00000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133676   Gene: ENSMUSG00000003617   Transcript: ENSMUST00000173848
Sequence length 120
Comment pep:putative chromosome:GRCm38:3:19982003:19985903:1 gene:ENSMUSG00000003617 transcript:ENSMUST00000173848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSKYKKVVYRQFTDSSFREQVKRRAEDEHLGILGPPIHANVGDKVKVVFKNMATRPYSIH
AHGVKTESSTVVPTLPGEVRTYTWQIPERSGAGREDSACIPWAYYSTVDRVKVNFKPSLL
Download sequence
Identical sequences G3UXG1
ENSMUSP00000133676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]