SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133704 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133704
Domain Number 1 Region: 19-247
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.2e-70
Family Nuclear receptor ligand-binding domain 0.0000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133704   Gene: ENSMUSG00000069171   Transcript: ENSMUST00000127137
Sequence length 263
Comment pep:putative chromosome:GRCm38:13:78189672:78197930:-1 gene:ENSMUSG00000069171 transcript:ENSMUST00000127137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENIC
ELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAA
GLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAH
IESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIE
TLIRDMLLSGSSFNWPYMSIQCS
Download sequence
Identical sequences A0A2K6PNS7 B8JJI9 G1RUE4 G3IA21
XP_012658267.1.62490 XP_017170868.1.92730 XP_019511475.1.44202 XP_019575657.1.88060 XP_021063929.1.100879 ENSMUSP00000118161 ENSMUSP00000133704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]