SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000134027 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000134027
Domain Number 1 Region: 44-446
Classification Level Classification E-value
Superfamily Ras GEF 1.23e-97
Family Ras GEF 0.00047
Further Details:      
 
Domain Number 2 Region: 489-557
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.29e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 438-494
Classification Level Classification E-value
Superfamily EF-hand 0.00000000103
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000134027   Gene: ENSMUSG00000027347   Transcript: ENSMUST00000173541
Sequence length 760
Comment pep:novel chromosome:GRCm38:2:117282542:117342709:-1 gene:ENSMUSG00000027347 transcript:ENSMUST00000173541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTLGKAREAPRKPCHGSRAGPKARLEAKSTNSPLPAQPSLAQITQFRMMVSLGHLAKGA
SLDDLIDSCIQSFDADGNLCRNNQLLQVMLTMHRIIISSAELLQKVMNLYKDALEKNSPG
VCLKICYFVRYWITEFWIMFKMDASLTSTMEEFQDLVKANGEETHCHLIDTTQINSRDWS
RKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKE
NPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIHVAQKLHQLQNFNTLMAVIGG
LCHSSISRLKETSSHVPHEINKVLGEMTELLSSCRNYDNYRRAYGECTHFKIPILGVHLK
DLISLYEAMPDYLEDGKVNVQKLLALYNHINELVQLQEMAPPLDANKDLVHLLTLSLDLY
YTEDEIYELSYAREPRNHRAPSVFKNYDLDQDGYISQEEFEKIAASFPFSFCVMDKDREG
LISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDC
GMNCHKQCKDLVVFECKKRIKSPAISTENISSVVPMSTLCPLGTKDLLHAPEEGSFIFQN
GEIVDHSEESKDRTIMLLGVSSQKISVRLKRTVAHKSTQTESFPWVGGETTPGHFVLSSP
RKSAQGALYVHSPASPCPSPALVRKRAFVKWENKESLIKPKPELHLRLRTYQELEQEINT
LKADNDALKIQLKYAQKKIESLQLGKSNHVLAQMDHGDSA
Download sequence
Identical sequences G3UYC3
ENSMUSP00000134027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]