SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000134312 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000134312
Domain Number 1 Region: 200-288
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.08e-34
Family Ras-binding domain, RBD 0.00000604
Further Details:      
 
Domain Number 2 Region: 2-86
Classification Level Classification E-value
Superfamily Ras GEF 0.0000000000222
Family Ras GEF 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000134312   Gene: ENSMUSG00000041354   Transcript: ENSMUST00000173284
Sequence length 315
Comment pep:putative chromosome:GRCm38:17:33933925:33937224:1 gene:ENSMUSG00000041354 transcript:ENSMUST00000173284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKDLVMLDAASKDELENGYINFDKRRKKECRGYDLRPNSDIQQWLQGLQPLTEAQSHRVS
CEVEPPGTSDSPAARTPRPTLVITQWTEVLGSVGGPTPLVSWDRPSVGGDEVPGTPAPLL
TRLAQHMKWPSVSSLDSALESSPSLHSPADPGHLSPPASSPRPSRGHRRSASCGSPLSGN
TGEGTSRSAGCGGGVSGPGSSDCRIIRVQMELGEDGSVYKSILVTSQDKAPSVISRVLKK
NNRDSAVASEFELVQLLPGDRELTIPHSANVFYAMDGASHDFLLRQRRRPSAATPGSHSG
PSASGTPPSEGGGGS
Download sequence
Identical sequences ENSMUSP00000134312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]