SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000134347 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000134347
Domain Number 1 Region: 24-55
Classification Level Classification E-value
Superfamily Cupredoxins 0.0000925
Family Multidomain cupredoxins 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000134347   Gene: ENSMUSG00000003617   Transcript: ENSMUST00000172605
Sequence length 58
Comment pep:known chromosome:GRCm38:3:19980628:19987396:1 gene:ENSMUSG00000003617 transcript:ENSMUST00000172605 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XTGGMKQKYTVNQCQRQFEDFTVYLGERTYYVAAVEVEWDYSPSRAWEKELHHLQEQK
Download sequence
Identical sequences G3UZ53
ENSMUSP00000134347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]