SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000134366 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000134366
Domain Number 1 Region: 63-260
Classification Level Classification E-value
Superfamily ARM repeat 2.14e-16
Family HEAT repeat 0.037
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000134366
Domain Number - Region: 18-82
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00116
Family Protein kinases, catalytic subunit 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000134366   Gene: ENSMUSG00000069539   Transcript: ENSMUST00000174492
Sequence length 274
Comment pep:putative chromosome:GRCm38:10:89650750:89660161:-1 gene:ENSMUSG00000069539 transcript:ENSMUST00000174492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSFSRQLDQLSRLGSSSLTSIPEEVREHVKLLLNVTPTVRPDADQMTKIPFFDDVGAVTL
QYFDTLFQRDNLQKSQFFKGLPKVLPKLPKRVIVQRILPCLTSEFVNPDMVPFVLPNVLL
IAEECTKEEYIKLILPELGPVFKQQEPIQILLIFLQKMDLLLTKTPPDEIKNSVLPMVYR
ALEAPSIQIQELCLNIIPTFANLIDYPSMKNALIPRIKNACLQTSSLAVRVNSLVCLGKI
LEYLDKWFVLDDILPFLQQIPSKEPAVLMGILGS
Download sequence
Identical sequences Q80UY7
ENSMUSP00000134366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]