SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000134483 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000134483
Domain Number 1 Region: 90-150
Classification Level Classification E-value
Superfamily Homeodomain-like 1.09e-22
Family Homeodomain 0.0019
Further Details:      
 
Domain Number 2 Region: 9-71
Classification Level Classification E-value
Superfamily Homeodomain-like 3.01e-17
Family Homeodomain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000134483   Gene: ENSMUSG00000048502   Transcript: ENSMUST00000173580
Sequence length 189
Comment pep:known chromosome:GRCm38:14:25979401:25988909:1 gene:ENSMUSG00000048502 transcript:ENSMUST00000173580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSCSTGLLEKEARRRRIILTQSQKDTLRVWFEKNPNPDLATRGHLAKELGISESQIMT
WFQKHRKIRKQAEFACCSEESQEQEQDKPRVKEARRSRTHFTKFQTDILIEAFEKNRFPG
IVTREKLAQQTGIPESRIHIWFQNRRARHPDPGQNTQKTPHPPQSSQGPTQKTVGKLAPS
KTLTSSASV
Download sequence
Identical sequences G3UX37 K9J7G7 L7MUF5
ENSMUSP00000133538 ENSMUSP00000133830 ENSMUSP00000134483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]