SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000134587 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000134587
Domain Number 1 Region: 4-160
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-33
Family Nuclear receptor ligand-binding domain 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000134587   Gene: ENSMUSG00000024955   Transcript: ENSMUST00000173635
Sequence length 161
Comment pep:putative chromosome:GRCm38:19:6912452:6921761:-1 gene:ENSMUSG00000024955 transcript:ENSMUST00000173635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAPVNALVSHLLVV
EPEKLYAMPDPASPDGHLPAVATLCDLFDREIVVTISWAKSIPGFSSLSLSDQMSVLQSV
WMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAAGLGDL
Download sequence
Identical sequences G3UZQ2
ENSMUSP00000134587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]