SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000134835 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000134835
Domain Number 1 Region: 1-35
Classification Level Classification E-value
Superfamily SAP domain 0.000000000000172
Family SAP domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000134835   Gene: ENSMUSG00000028101   Transcript: ENSMUST00000176302
Sequence length 52
Comment pep:known chromosome:GRCm38:3:96697194:96701691:1 gene:ENSMUSG00000028101 transcript:ENSMUST00000176302 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MVMSFRVSELQVLLGFAGRNKSGRKHELLAKALSVRWTCILLCRSLCTPMSP
Download sequence
Identical sequences H3BJ41
ENSMUSP00000134835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]