SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000134900 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000134900
Domain Number 1 Region: 117-423
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.49e-70
Family Papain-like 0.0000113
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000134900
Domain Number - Region: 53-94
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0334
Family Somatomedin B domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000134900   Gene: ENSMUSG00000028776   Transcript: ENSMUST00000175992
Sequence length 435
Comment pep:novel chromosome:GRCm38:4:130165604:130174792:-1 gene:ENSMUSG00000028776 transcript:ENSMUST00000175992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGCWLGLLLLLLAGQAALEARRSRWRRELAPGLHLRGIRDAGGRYCQEQDMCCRGRADE
CALPYLGATCYCDLFCNRTVSDCCPDFWDFCLGIPPPFPPVQGCMHGGRIYPVFGTYWDN
CNRWWQAGNHSAFWGMTLDEGIRYRLGTIRPSSTVMNMNEIYTVLGQGEVLPTAFEASEK
WPNLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPILSPQNLLSCDTHHQQGCRG
GRLDGAWWFLRRRGVVSDNCYPFSGREQNEASPTPRCMMHSRAMGRGKRQATSRCPNGQV
DSNDIYQVTPAYRLGSDEKEIMKELMENGPVQALMEVHEDFFLYQRGIYSHTPVSQGRPE
QYRRHGTHSVKITGWGEETLPDGRTIKYWTAANSWGPWWGERGHFRIVRGTNECDIETFV
LGVWGRVGMEDMGHH
Download sequence
Identical sequences H3BJ97
ENSMUSP00000134900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]