SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000135290 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000135290
Domain Number 1 Region: 107-250
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.36e-33
Family cAMP-binding domain 0.000000204
Further Details:      
 
Domain Number 2 Region: 2-104
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-25
Family cAMP-binding domain 0.00000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000135290   Gene: ENSMUSG00000002997   Transcript: ENSMUST00000146865
Sequence length 256
Comment pep:putative chromosome:GRCm38:12:31958480:32060589:-1 gene:ENSMUSG00000002997 transcript:ENSMUST00000146865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFG
ELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEV
SERLKVVDVIGTKVYNDGEQIIAQGDLADSFFIVESGEVKITMKRKGKSEVEENGAVEIA
RCFRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQ
LVALFGTNMDIVEPTA
Download sequence
Identical sequences G3I9B3 H3BK84
ENSMUSP00000135290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]