SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000135317 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000135317
Domain Number 1 Region: 2-156,186-216
Classification Level Classification E-value
Superfamily Ras GEF 4.71e-63
Family Ras GEF 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000135317   Gene: ENSMUSG00000022469   Transcript: ENSMUST00000134885
Sequence length 216
Comment pep:putative chromosome:GRCm38:15:97745168:97767666:-1 gene:ENSMUSG00000022469 transcript:ENSMUST00000134885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRFNELQYWVATELCLCPVPGSRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAIS
RLAHTWERLPHKVRKLYSALERLLDPSWNHRVYRLALTKLSPPVIPFMPLLLKDVTFIHE
GNHTLVENLINFEKMRMMARAVRMLHHCRSHSTAPLSPLRSRVSHIHEDSQGSRISTCSE
QSLSTRSPASTWAYVQQLKVIDNQRELSRLSRELEP
Download sequence
Identical sequences H3BKA8
ENSMUSP00000135317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]