SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000135453 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000135453
Domain Number - Region: 116-140
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00017
Family PMP inhibitors 0.0044
Further Details:      
 
Domain Number - Region: 54-95
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00085
Family Somatomedin B domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000135453   Gene: ENSMUSG00000028776   Transcript: ENSMUST00000132545
Sequence length 161
Comment pep:known chromosome:GRCm38:4:130169113:130174691:-1 gene:ENSMUSG00000028776 transcript:ENSMUST00000132545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGCWLGLLLLLLAGQAALEARRSRWRRELAPGLHLRGIRDAGGRYCQEQDMCCRGRADE
CALPYLGATCYCDLFCNRTVSDCCPDFWDFCLGIPPPFPPVQGCMHGGRIYPVFGTYWDN
CNRCTCHEGGHWECDQEPCLVDPDMIKAINRGNYGWQAGNH
Download sequence
Identical sequences H3BKM8
ENSMUSP00000135453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]