SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000135456 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000135456
Domain Number - Region: 7-37
Classification Level Classification E-value
Superfamily Cupredoxins 0.0438
Family Multidomain cupredoxins 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000135456   Gene: ENSMUSG00000052752   Transcript: ENSMUST00000175698
Sequence length 84
Comment pep:known chromosome:GRCm38:17:24511597:24513339:-1 gene:ENSMUSG00000052752 transcript:ENSMUST00000175698 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XVNNIAVAEQIGELFIHCRHGCHAAGTGKPGVFEVDPRGCPFTIKLSARNSTSVSCVCTG
TTRVVVTTGLCAAPTTPAAHPFSR
Download sequence
Identical sequences H3BKN1
ENSMUSP00000135456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]