SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000135464 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000135464
Domain Number 1 Region: 9-31,84-107
Classification Level Classification E-value
Superfamily Pseudouridine synthase 0.0000036
Family Pseudouridine synthase RsuA/RluD 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000135464   Gene: ENSMUSG00000039826   Transcript: ENSMUST00000156846
Sequence length 121
Comment pep:known chromosome:GRCm38:2:29774684:29787660:-1 gene:ENSMUSG00000039826 transcript:ENSMUST00000156846 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGSSGLARLQGLFAVYKPPGLKWLHLRETVELQLLKGLNAQQPPAPDQRVRFLLGPVEGS
EEKKLTLRATNVPSLTTHRLVRGPAFTNLKIGVGHRLDVQASGVLGLHSAWPPGQSYRQL
L
Download sequence
Identical sequences H3BLS1
ENSMUSP00000134787 ENSMUSP00000135464 ENSMUSP00000135893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]