SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000136252 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000136252
Domain Number 1 Region: 4-106
Classification Level Classification E-value
Superfamily dUTPase-like 6.02e-17
Family dUTPase-like 0.0027
Further Details:      
 
Domain Number 2 Region: 91-147
Classification Level Classification E-value
Superfamily Acid proteases 4.22e-16
Family Retroviral protease (retropepsin) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000136252   Gene: ENSMUSG00000096528   Transcript: ENSMUST00000179907
Sequence length 166
Comment pep:known chromosome:GRCm38:18:3471630:3474315:1 gene:ENSMUSG00000096528 transcript:ENSMUST00000179907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQLTAVNTGEFGPPPQKTFFLIISRVSRLLQGLMVTPTVVDTDYHGEIKILVTATQEPL
TLRAGERVAQALPLPLFGHFPYMKEERGPSSLGSSEVYWAQKITDSWPMLTLFLEDKQFQ
GLLDTGADVTVISSTHWPAAWPLQPTKGWCNPLIIKFTAKGRNLEA
Download sequence
Identical sequences Q3TL09
ENSMUSP00000136252 ENSMUSP00000136252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]