SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000136278 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000136278
Domain Number 1 Region: 146-268
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 4.71e-32
Family Troponin T 0.0000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000136278   Gene: ENSMUSG00000061723   Transcript: ENSMUST00000179658
Sequence length 272
Comment pep:known chromosome:GRCm38:7:142498836:142516008:1 gene:ENSMUSG00000061723 transcript:ENSMUST00000179658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDEETEQVEEQYEEEEEAQEEEVQEEAPEPEEVQEDAVAEEEREEDEEEEKPRPKLTAP
KIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEELIALKERIEKRRAERAEQ
QRIRAEKERERQNRLAEEKARREEEDAKRRAEDDMKKKKALSSMGANYSSYLAKADQKRG
KKQTAREMKKKILAERRKPLNIDHLSDDKLRDKAKELWDTLYQLETDKFEFGEKLKRQKY
DITTLRSRIDQAQKHSKKAGATAKGKVGGRWK
Download sequence
Identical sequences Z4YNB2
ENSMUSP00000077587 ENSMUSP00000101561 ENSMUSP00000136278 NP_001157136.1.92730 XP_021055288.1.100879 10090.ENSMUSP00000077587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]