SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000136386 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000136386
Domain Number 1 Region: 81-322,632-650
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.2e-34
Family Calpain large subunit, catalytic domain (domain II) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000136386
Domain Number - Region: 786-855
Classification Level Classification E-value
Superfamily Globin-like 0.000347
Family Globins 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000136386   Gene: ENSMUSG00000050994   Transcript: ENSMUST00000179956
Sequence length 1660
Comment pep:known chromosome:GRCm38:10:10335703:10472314:-1 gene:ENSMUSG00000050994 transcript:ENSMUST00000179956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKQAKRKEVHRINSAHGSDKSKDLYHFGSNVPPGSFEQKKGKFPIWPEWSEADINAEK
WDAGKGGKEKDKTAKSPIFHFFEDPEGKIELPQSLKVFSWKRPQDFIFSRTPVVVKNEIT
FDLFSPNEHLLCSELMRWIISEIYAVWKIFNGGILSNYHKGNLGELPILPWKPWEHIYSL
CKAVKGHVPLFNSYGKYVVKLYWMGCWRKITVDDFLPFDEENNLLLPATSYEFELWPMLL
SKAIIKLANVDVHVAHRRELGELTVIHALTGWLPEVIPLHPAYVDRVWELLKEILPEFKL
TEEPSSESKITTIDNKLKEDGKDGKDGKDGKDGKDGKDSKDFKLEVSLTNLKIPEKVDRA
AKEKADARDLGKKNKKDGEKEKEKFKFSLHGSRPSSDVQYSMQSLSECSSAIQLPHMVVY
ATFTPLYLFENKIFSLEKMANSAEKLREYGLSHICSHPVLVTRSRSCPLVSPPKPPPLPA
WKLIRHKKETVITDEAQDAVPKKPEQFLEISSPFLNYRMTPFTIPTETHFVQSVIKKGTP
LGSSLPPLVENDLVASTSQGEMSIVNGNQSQGNIALQITLGKGKDEPSEPALADFHQLEA
TSLDRDLISLTTATLDKSQEELAINEGVAKEIWLDFEDFCVCFHHIYIFHKPHSYCLNFQ
KSEFKFVEERVPYYLFVDSLKPIELLVCFSALVRWGESGALTKDSPPVEPGLLTAEAITW
KSLKPLSVVLRIHTYATKASVVRLPAGRHMLLFNAYSPVGHAIHVCSMTTFVIGDEDIVL
PNFEPESYRFTEQSIIIMKAIGNVIANFKDKGKLPAALRDLQAAHYPIPLNNKELTAQHF
RVFHISLWRLMKKSQVAKPPSNFKFAFRAMVFDTDLLDSFSEDVSLAEWVDLKYSTPINE
KEYTSEEIAAAVKIQSMWKGCYVRLLMKARKPETKENVTVADTLQKIWAVLEMNLEQYAL
SLLRLMFKSKCKSMESYPCYQDEETKLAFADHTVNYADQPPNSWFIVFREIFLVPQDMII
LPKVYTTLPICILHVINNDTLEQVPKVFQKVVPFLYTKNKKGYTFVAEAYTGDTFVSGAR
WKLRLIGSYNPLPFLARDSPCNTFSIKEIRDYYIPNDRKILFRYSIKVTVAQSITIQVRT
SKPDTFIKLQVLESEEVITSTVGKGQAVIPAFYFLGNEKALSSQSSKQVLLSHPSPKKDP
EVLTKKKSGQPGQKSFKGRSGGGLTDTGMPLLEEEILNIPTLEENSSTPQQCYKYIIQCL
VLFNSWPLNETQLTFVQALKDMEKMDIKAEKHEEPAPMGSPDSHAVSEGQKSVGVPKTTR
KGKEKSAEKEKLAKEKQAPRFEPQQVQMPTAVHSQQEDPNKPYWILRLVSEHTDSDYVDV
KKDTERADEIRAMKQAWETTEPGRAIKAAQARLKYLTQFIKKPVTTDTTTSAPSPETLSV
SQSQTKSSEEGELDTGKYADIKELPPNAAGSVLWKKWQMTKTITSLTKFTSSESVPKEEP
PQKEIPVVRQRSPTILETSPQQIRKALEFLDFSHYVRKTAAEAVLQTEELNKQQAMQKAE
EIHQFRQHRSRILSIRDIDQEERFKQKDEVLEMYGEMRDSVDEARQKILDIREVYRNKLL
EAERLRMEALAAQEAAVKIEIEKKSPASDSQKKKKVGKKK
Download sequence
Identical sequences J3QMP3
ENSMUSP00000136386 ENSMUSP00000136386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]