SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000136402 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000136402
Domain Number 1 Region: 39-99,145-237,265-415
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.15e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000196
Further Details:      
 
Domain Number 2 Region: 392-517
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.06e-30
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000712
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000136402   Gene: ENSMUSG00000075704   Transcript: ENSMUST00000177856
Sequence length 522
Comment pep:known chromosome:GRCm38:16:18426438:18479067:1 gene:ENSMUSG00000075704 transcript:ENSMUST00000177856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAAMVAALRGPSRRFRPRTRALTRGTRGAASAAGGQQSFDLLVIGGGSGGLACAKEAAQ
LGKKVAVADYVEPSPRGTKWGLGGTCVNVGCIPKKLMHQAALLGGMIRDAHHYGWEVAQP
VQHNWKTMAEAVQNHVKSLNWGHRVQLQDRKVKYFNIKASFVDEHTVRGVDKGGKATLLS
AEHIVIATGGRPRYPTQVKGALEYGITSDDIFWLKESPGKTSVPAAEDVALECAGFLTGI
GLDTTVMMRSIPLRGFDQQMSSLVTEHMESHGTQFLKGCVPSHIKKLPTNQLQVTWEDHA
SGKEDTGTFDTVLWAIGRVPETRTLNLEKAGISTNPKNQKIIVDAQEATSVPHIYAIGDV
AEGRPELTPTAIKAGKLLAQRLFGKSSTLMDYSNVPTTVFTPLEYGCVGLSEEEAVALHG
QEHVEVYHAYYKPLEFTVADRDASQCYIKMVCMREPPQLVLGLHFLGPNAGEVTQGFALG
IKCGASYAQVMQTVGIHPTCSEEVVKLHISKRSGLEPTVTGC
Download sequence
Identical sequences J3QMQ8
ENSMUSP00000136402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]