SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000136423 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000136423
Domain Number 1 Region: 44-463
Classification Level Classification E-value
Superfamily Ras GEF 9.68e-102
Family Ras GEF 0.00046
Further Details:      
 
Domain Number 2 Region: 524-592
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.59e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 371-390,459-529
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000879
Family Calmodulin-like 0.036
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000136423
Domain Number - Region: 745-779
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0418
Family Mitotic arrest deficient-like 1, Mad1 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000136423   Gene: ENSMUSG00000027347   Transcript: ENSMUST00000178884
Sequence length 795
Comment pep:known chromosome:GRCm38:2:117279994:117342877:-1 gene:ENSMUSG00000027347 transcript:ENSMUST00000178884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTLGKAREAPRKPCHGSRAGPKARLEAKSTNSPLPAQPSLAQITQFRMMVSLGHLAKGA
SLDDLIDSCIQSFDADGNLCRNNQLLQVMLTMHRIIISSAELLQKVMNLYKDALEKNSPG
VCLKICYFVRYWITEFWIMFKMDASLTSTMEEFQDLVKANGEETHCHLIDTTQINSRDWS
RKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKE
NPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIHVAQKLHQLQNFNTLMAVIGG
LCHSSISRLKETSSHVPHEINKVLGEMTELLSSCRNYDNYRRAYGECTHFKIPILGVHLK
DLISLYEAMPDYLEDGKVNVQKLLALYNHINELVQLQEMAPPLDANKDLVHLLTLSLDLY
YTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFK
NYDLDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGF
PHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRIKSPAI
STENISSVVPMSTLCPLGTKDLLHAPEEGSFIFQNGEIVDHSEESKDRTIMLLGVSSQKI
SVRLKRTVAHKSTQTESFPWVGGETTPGHFVLSSPRKSAQGALYVHSPASPCPSPALVRK
RAFVKWENKESLIKPKPELHLRLRTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLG
KSNHVLAQMDHGDSA
Download sequence
Identical sequences Q9Z1S3
NP_035376.1.92730 ENSMUSP00000099593 ENSMUSP00000099593 10090.ENSMUSP00000028823 ENSMUSP00000099593 ENSMUSP00000136423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]