SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000136735 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000136735
Domain Number 1 Region: 70-186
Classification Level Classification E-value
Superfamily Ras GEF 2.35e-17
Family Ras GEF 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000136735   Gene: ENSMUSG00000096344   Transcript: ENSMUST00000179032
Sequence length 320
Comment pep:known chromosome:GRCm38:5:146481943:146484702:1 gene:ENSMUSG00000096344 transcript:ENSMUST00000179032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSCFQGSRGSGHKKAKSGFLVRFWRRLIRPLTHFRHASHSEPKVCSQNEQEPDCMPRRP
RFNYNSPEYVVQMIHYIPAAVQHNDHVCIRIFLAMYPSYASTWKVLDLLMTTYAFFLPDR
IKDQETKRAIFRFLFHWFKKFPKDFYESPDLAVVRQFIDYVRHNVPSADEDTQARELLSV
LEEQEAIGLNPEEDFATAPEPSEQDASGRQETLAPRPASETEPQGDKQPREDPELVKGAV
LDPSEPKATIELPPSLHQAVPTSDGTLSPVDVTADEATGVAADEAADVAADVSPARQLFV
SYTVQLGTPDFVIPLPEVDI
Download sequence
Identical sequences J3QNG1
ENSMUSP00000136735 ENSMUSP00000136735 PGOMOU00000127457 NP_001230033.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]