SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000136756 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000136756
Domain Number 1 Region: 51-215
Classification Level Classification E-value
Superfamily Ras GEF 1.7e-36
Family Ras GEF 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000136756   Gene: ENSMUSG00000096405   Transcript: ENSMUST00000177985
Sequence length 218
Comment pep:novel chromosome:GRCm38:14:36094917:36096857:1 gene:ENSMUSG00000096405 transcript:ENSMUST00000177985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSWCLRTTRGLGLKKENREGHGSVWRHRVHSCLQRLWPFSRKGKTVTKGKQDQNHTDQD
LREPRRESPISAEMVVKLVNNLVPSLQEGDHFFVSIFLSTYRSFVTPLQVLGLLFMRYPY
FHPHSVEHRQVRSSLCNFLHTWMDKNPEDFCDPSDMLPLTYLKAYLSVHMPHSELFIRVD
RLLNELWEEQDKDSHAKNEEDSDLGRHTSSDPELKRCK
Download sequence
Identical sequences Q8BVR5
ENSMUSP00000058328 10090.ENSMUSP00000058328 ENSMUSP00000136756 NP_778173.1.92730 ENSMUSP00000136756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]