SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000137309 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000137309
Domain Number 1 Region: 21-109
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-23
Family Linker histone H1/H5 0.000081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000137309   Gene: ENSMUSG00000096210   Transcript: ENSMUST00000180086
Sequence length 194
Comment pep:known chromosome:GRCm38:15:79028212:79030498:1 gene:ENSMUSG00000096210 transcript:ENSMUST00000180086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKV
GENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKGDEPKRSVAFKKTKKEVKKVATP
KKAAKPKKAASKAPSKKPKATPVKKAKKKPAATPKKAKKPKVVKVKPVKASKPKKAKTVK
PKAKSSAKRASKKK
Download sequence
Identical sequences P10922
NP_032223.2.92730 ENSMUSP00000137309 ENSMUSP00000137309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]