SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000137596 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000137596
Domain Number 1 Region: 127-255
Classification Level Classification E-value
Superfamily DNA clamp 3.14e-47
Family DNA polymerase processivity factor 0.00000048
Further Details:      
 
Domain Number 2 Region: 1-126
Classification Level Classification E-value
Superfamily DNA clamp 3.43e-42
Family DNA polymerase processivity factor 0.00000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000137596   Gene: ENSMUSG00000067608   Transcript: ENSMUST00000088040
Sequence length 261
Comment pep:known chromosome:GRCm38:19:9283238:9284494:1 gene:ENSMUSG00000067608 transcript:ENSMUST00000088040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEARLIQGSILKKVLEALKDLINEACWDVSSGGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVIKMPSSEFARICRDLSHIGDAVVISCAKNGVKFSASGELGNGNI
KLSQTSNVDKEEEAVAIEMNEPVHLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEAS
Download sequence
Identical sequences A0A140T8V5
ENSMUSP00000137596 ENSMUSP00000137596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]