SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000137642 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000137642
Domain Number 1 Region: 253-562
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.23e-115
Family Transglutaminase core 0.0000000204
Further Details:      
 
Domain Number 2 Region: 103-252
Classification Level Classification E-value
Superfamily E set domains 3.32e-45
Family Transglutaminase N-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 576-687
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.67e-30
Family Transglutaminase, two C-terminal domains 0.00056
Further Details:      
 
Domain Number 4 Region: 688-787
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.53e-29
Family Transglutaminase, two C-terminal domains 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000137642   Gene: ENSMUSG00000022218   Transcript: ENSMUST00000178034
Sequence length 815
Comment pep:known chromosome:GRCm38:14:55700009:55713492:-1 gene:ENSMUSG00000022218 transcript:ENSMUST00000178034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGPRSDVGRWGRSPWQPPTTPSPEPEPVPEPDRRSRSRRGGGRSFWARCCGCCSCGNRG
DDDWGPEPSGSRSRGTSSRGRDSRGGRRPESRGSGVNAAGDGTIREGMLVVTGVDLLCSR
SDQNRREHHTDEFEYDELIVRRGQPFHMILFLNREYESSDRIALELLIGSNPEVGKGTHV
IIPVGKGGSGGWKAQVTKNNGHNLNLRVHTSPNAIIGKFQFTVRTRSEAGEFQLPFDPRN
EIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDAC
LYILDRRGMPYGGRGDPVSVSRVVSAMVNSLDDNGVLIGNWTGDYSRGTNPSAWVGSVEI
LLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGFATRTVTNFNSAHDTDTSLTMDIYFDENM
KPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESVK
NGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAIHSNNREDIT
HIYKHPEGSEAERRAVEKAAAHGSKPNVYATRDSAEDVAMQVEAQDAVMGQDLAVSVVLT
NRGSSRRTVKLHLYLCVTYYTGVSGPTFKEAKKEVTLAPGASDSVTMPVAYKEYKPHLVD
QGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECGVQIVFKNPLPVTL
TNVVFRLEGSGLQRPKVLNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHGV
IQVDVAPASGGSGFSDAGGDSRSGENIPMAYRGGA
Download sequence
Identical sequences A0A0R4J293
ENSMUSP00000002389 ENSMUSP00000002389 NYSGRC-IgSF-Q9JLF6 ENSMUSP00000002389 ENSMUSP00000128090 ENSMUSP00000137642 NP_001155186.1.92730 NP_001155187.1.92730 NP_064368.3.92730 XP_006518871.1.92730 XP_006518872.1.92730 10090.ENSMUSP00000002389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]