SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000137683 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000137683
Domain Number 1 Region: 2-220
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-61
Family Nuclear receptor ligand-binding domain 0.00000000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000137683   Gene: ENSMUSG00000005677   Transcript: ENSMUST00000155126
Sequence length 221
Comment pep:putative chromosome:GRCm38:1:171213986:171220701:1 gene:ENSMUSG00000005677 transcript:ENSMUST00000155126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDQFVQFKPPAYLFMHHRPFQPRGPVLPLLTHFADINTFMVQQIIKFTKDLPLFRSLTM
EDQISLLKGAAVEILHISLNTTFCLQTENFFCGPLCYKMEDAVHAGFQYEFLESILHFHK
NLKGLHLQEPEYVLMAATALFSPDRPGVTQREEIDQLQEEMALILNNHIMEQQSRLQSRF
LYAKLMGLLADLRSINNAYSYELQRLEELSAMTPLLGEICS
Download sequence
Identical sequences Q3UEP1
XP_006496692.1.92730 XP_006496693.1.92730 ENSMUSP00000137683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]