SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000137888 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000137888
Domain Number 1 Region: 26-204
Classification Level Classification E-value
Superfamily Tropomyosin 0.000016
Family Tropomyosin 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000137888   Gene: ENSMUSG00000060180   Transcript: ENSMUST00000181027
Sequence length 223
Comment pep:novel chromosome:GRCm38:11:67364785:67369204:1 gene:ENSMUSG00000060180 transcript:ENSMUST00000181027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XFGRPVGSWFTLKLCHHSWFPLKDSQLHLDDAQRSNEDLKEQLAIVERRNGLLQEELEEM
KVALEQTERTRRLSEQELLDSSDRVQLLHSQNTSLINTKKKLEADLAQCQAEVENSIQES
RNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGG
KKQIQKLEARVRELESELDAEQKRGAEALKGAHKYERKVKEMT
Download sequence
Identical sequences M0QWL0
ENSMUSP00000137888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]