SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000137941 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000137941
Domain Number 1 Region: 5-44
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.000000017
Family D-ribulose-5-phosphate 3-epimerase 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000137941   Gene: ENSMUSG00000026005   Transcript: ENSMUST00000142920
Sequence length 71
Comment pep:known chromosome:GRCm38:1:66700831:66719805:1 gene:ENSMUSG00000026005 transcript:ENSMUST00000142920 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHPALQGGQFFCILFPISLL
VTLWLKASESS
Download sequence
Identical sequences M0QWQ0
ENSMUSP00000137941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]