SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000137953 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000137953
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.63e-20
Family KRAB domain (Kruppel-associated box) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000137953   Gene: ENSMUSG00000069206   Transcript: ENSMUST00000180580
Sequence length 78
Comment pep:known chromosome:GRCm38:13:67440433:67451580:-1 gene:ENSMUSG00000069206 transcript:ENSMUST00000180580 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MEEMLSFWDVAIDFSPEEKECLEPAQWDLYRDVMLENFSHLDFLGLAVAKPYLVTFLEQN
QGSSGVKSQTSATIPPGV
Download sequence
Identical sequences M0QWQ8
ENSMUSP00000137953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]